Beta-Defensin-2 (hBD-2)
Antimicrobial- Molecular Formula
- C193H311N61O52S6
- Molar Mass
- 4,328.2 g/mol
- CAS Number
- 222101-52-0
- Purity Standard
- 98%+ (HPLC Verified)
- Amino Acid Sequence
- GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (41-amino acid peptide with three disulfide bonds)
Overview
Human beta-defensin-2 (hBD-2) is an inducible antimicrobial peptide produced by epithelial cells throughout the body, particularly in skin, respiratory tract, and gastrointestinal epithelium. Unlike constitutively expressed hBD-1, hBD-2 is strongly upregulated in response to infection, inflammation, and epithelial injury.
The 41-amino acid peptide contains six cysteine residues forming three disulfide bonds in the characteristic beta-defensin pattern, distinct from the alpha-defensin connectivity. This fold creates a cationic, amphipathic structure capable of membrane disruption against gram-positive and gram-negative bacteria, fungi, and some viruses.
Beyond direct antimicrobial activity, hBD-2 functions as a chemokine, attracting immature dendritic cells and memory T cells through CCR6 receptor activation. This links the innate epithelial defense to adaptive immunity, making hBD-2 a key mediator at the interface between immediate antimicrobial protection and organized immune responses.
Research has revealed hBD-2's involvement in inflammatory skin conditions including psoriasis, where dramatically elevated expression contributes to both antimicrobial resistance and chronic inflammation. Understanding hBD-2 regulation and function has implications for treating skin infections, inflammatory diseases, and potentially developing novel antimicrobial or immunomodulatory therapeutics.
Synthesis Overview
Beta-defensin-2 is synthesized via Fmoc solid-phase peptide synthesis with orthogonal cysteine protection enabling regioselective formation of the three characteristic beta-defensin disulfide bonds (Cys1-Cys5, Cys2-Cys4, Cys3-Cys6). The 41-amino acid sequence requires careful optimization of coupling conditions. Following synthesis and controlled oxidative folding, preparative HPLC separates correctly folded product. Antimicrobial activity and CCR6 binding assays confirm biological function.
Research Applications
- Inducible epithelial antimicrobial defense research
- Skin innate immunity and infection response studies
- CCR6-mediated chemotaxis and immune cell recruitment investigation
- Psoriasis and inflammatory skin disease research
- Wound healing and barrier defense studies
- Antimicrobial peptide expression regulation research
Related Compounds
C205H340N60O53
4,493.33 g/mol
LL-37 is the only human cathelicidin-derived antimicrobial peptide, cleaved from the precursor protein hCAP18 by serine proteases at sites of infectio...
View Full ProfileC148H243N49O38S6
3,442.3 g/mol
Alpha-defensin HNP-1 (Human Neutrophil Peptide-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils and released durin...
View Full ProfileC80H122N22O11
1,579.9 g/mol
Indolicidin is a unique tryptophan-rich antimicrobial peptide isolated from cytoplasmic granules of bovine neutrophils. Its remarkably high tryptophan...
View Full Profile