Beta-Defensin-2 (hBD-2)

Antimicrobial
Chemical Profile
Molecular Formula
C193H311N61O52S6
Molar Mass
4,328.2 g/mol
CAS Number
222101-52-0
Purity Standard
98%+ (HPLC Verified)
Amino Acid Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (41-amino acid peptide with three disulfide bonds)

Overview

Human beta-defensin-2 (hBD-2) is an inducible antimicrobial peptide produced by epithelial cells throughout the body, particularly in skin, respiratory tract, and gastrointestinal epithelium. Unlike constitutively expressed hBD-1, hBD-2 is strongly upregulated in response to infection, inflammation, and epithelial injury.

The 41-amino acid peptide contains six cysteine residues forming three disulfide bonds in the characteristic beta-defensin pattern, distinct from the alpha-defensin connectivity. This fold creates a cationic, amphipathic structure capable of membrane disruption against gram-positive and gram-negative bacteria, fungi, and some viruses.

Beyond direct antimicrobial activity, hBD-2 functions as a chemokine, attracting immature dendritic cells and memory T cells through CCR6 receptor activation. This links the innate epithelial defense to adaptive immunity, making hBD-2 a key mediator at the interface between immediate antimicrobial protection and organized immune responses.

Research has revealed hBD-2's involvement in inflammatory skin conditions including psoriasis, where dramatically elevated expression contributes to both antimicrobial resistance and chronic inflammation. Understanding hBD-2 regulation and function has implications for treating skin infections, inflammatory diseases, and potentially developing novel antimicrobial or immunomodulatory therapeutics.

Synthesis Overview

Beta-defensin-2 is synthesized via Fmoc solid-phase peptide synthesis with orthogonal cysteine protection enabling regioselective formation of the three characteristic beta-defensin disulfide bonds (Cys1-Cys5, Cys2-Cys4, Cys3-Cys6). The 41-amino acid sequence requires careful optimization of coupling conditions. Following synthesis and controlled oxidative folding, preparative HPLC separates correctly folded product. Antimicrobial activity and CCR6 binding assays confirm biological function.

Research Applications

  • Inducible epithelial antimicrobial defense research
  • Skin innate immunity and infection response studies
  • CCR6-mediated chemotaxis and immune cell recruitment investigation
  • Psoriasis and inflammatory skin disease research
  • Wound healing and barrier defense studies
  • Antimicrobial peptide expression regulation research

Related Compounds