Alpha-Defensin (HNP-1)
Antimicrobial- Molecular Formula
- C148H243N49O38S6
- Molar Mass
- 3,442.3 g/mol
- CAS Number
- 118492-71-8
- Purity Standard
- 98%+ (HPLC Verified)
- Amino Acid Sequence
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (30-amino acid peptide with three intramolecular disulfide bonds)
Overview
Alpha-defensin HNP-1 (Human Neutrophil Peptide-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils and released during degranulation to kill phagocytosed microorganisms. It is one of the most abundant proteins in neutrophils, comprising approximately 5-7% of total neutrophil protein.
The 30-amino acid peptide contains six cysteine residues forming three intramolecular disulfide bonds in a characteristic defensin fold. This constrained structure creates an amphipathic molecule with cationic and hydrophobic surfaces that enables interaction with and disruption of microbial membranes.
HNP-1 demonstrates broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and some enveloped viruses. The mechanism involves electrostatic attraction to negatively charged microbial membranes, followed by insertion and pore formation that disrupts membrane integrity and osmotic balance.
Beyond direct antimicrobial activity, alpha-defensins function as immunomodulators, influencing chemotaxis, cytokine production, and adaptive immune responses. Elevated plasma levels of HNP-1 serve as biomarkers for neutrophil activation in infection, inflammation, and certain malignancies, making defensins valuable in both basic research and diagnostic applications.
Synthesis Overview
Alpha-defensin HNP-1 is synthesized via Fmoc solid-phase peptide synthesis with orthogonal protection of the six cysteine residues to enable sequential formation of the three specific disulfide bonds (Cys1-Cys6, Cys2-Cys4, Cys3-Cys5). This regioselective disulfide formation is critical for biological activity. Following synthesis and cleavage, disulfides are formed through controlled oxidation steps using orthogonal cysteine protecting groups. Purification via preparative HPLC separates correctly folded product from misfolded isomers. Activity is confirmed through antimicrobial assays.
Research Applications
- Innate immune defense mechanism research
- Broad-spectrum antimicrobial activity studies
- Neutrophil granule protein function investigation
- Membrane disruption and pore formation mechanism research
- Host defense peptide structure-activity relationship studies
- Biomarker applications for infection and inflammation research
Related Compounds
C205H340N60O53
4,493.33 g/mol
LL-37 is the only human cathelicidin-derived antimicrobial peptide, cleaved from the precursor protein hCAP18 by serine proteases at sites of infectio...
View Full ProfileC193H311N61O52S6
4,328.2 g/mol
Human beta-defensin-2 (hBD-2) is an inducible antimicrobial peptide produced by epithelial cells throughout the body, particularly in skin, respirator...
View Full ProfileC80H122N22O11
1,579.9 g/mol
Indolicidin is a unique tryptophan-rich antimicrobial peptide isolated from cytoplasmic granules of bovine neutrophils. Its remarkably high tryptophan...
View Full Profile