Alpha-Defensin (HNP-1)

Antimicrobial
Chemical Profile
Molecular Formula
C148H243N49O38S6
Molar Mass
3,442.3 g/mol
CAS Number
118492-71-8
Purity Standard
98%+ (HPLC Verified)
Amino Acid Sequence
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (30-amino acid peptide with three intramolecular disulfide bonds)

Overview

Alpha-defensin HNP-1 (Human Neutrophil Peptide-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils and released during degranulation to kill phagocytosed microorganisms. It is one of the most abundant proteins in neutrophils, comprising approximately 5-7% of total neutrophil protein.

The 30-amino acid peptide contains six cysteine residues forming three intramolecular disulfide bonds in a characteristic defensin fold. This constrained structure creates an amphipathic molecule with cationic and hydrophobic surfaces that enables interaction with and disruption of microbial membranes.

HNP-1 demonstrates broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and some enveloped viruses. The mechanism involves electrostatic attraction to negatively charged microbial membranes, followed by insertion and pore formation that disrupts membrane integrity and osmotic balance.

Beyond direct antimicrobial activity, alpha-defensins function as immunomodulators, influencing chemotaxis, cytokine production, and adaptive immune responses. Elevated plasma levels of HNP-1 serve as biomarkers for neutrophil activation in infection, inflammation, and certain malignancies, making defensins valuable in both basic research and diagnostic applications.

Synthesis Overview

Alpha-defensin HNP-1 is synthesized via Fmoc solid-phase peptide synthesis with orthogonal protection of the six cysteine residues to enable sequential formation of the three specific disulfide bonds (Cys1-Cys6, Cys2-Cys4, Cys3-Cys5). This regioselective disulfide formation is critical for biological activity. Following synthesis and cleavage, disulfides are formed through controlled oxidation steps using orthogonal cysteine protecting groups. Purification via preparative HPLC separates correctly folded product from misfolded isomers. Activity is confirmed through antimicrobial assays.

Research Applications

  • Innate immune defense mechanism research
  • Broad-spectrum antimicrobial activity studies
  • Neutrophil granule protein function investigation
  • Membrane disruption and pore formation mechanism research
  • Host defense peptide structure-activity relationship studies
  • Biomarker applications for infection and inflammation research

Related Compounds